Glutamate Receptor 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 2
  Conformer 1
(PDB)
1n0t (A)
  Conformer 2
(PDB)
1mqj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 118 0.38   7 - 11   16 - 16   36 - 108   219 - 257
2 23 0.41   12 - 15   17 - 35
3 29 0.38   109 - 111   192 - 208   212 - 218   258 - 259
4 83 0.38   112 - 191   209 - 211

Sequence


           _______11__15__________________35______________________________________________________________________108______________ 
 1n0t(A) : **TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIE 
         :                                                                                                                          
 1mqj(A) : NKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIE 
           _______11__15__________________35______________________________________________________________________108______________ 

           __________________________________________________________________191______________208______217_________________________ 
 1n0t(A) : SAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLN 
         :                                                                                                                          
 1mqj(A) : SAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLN 
           __________________________________________________________________191______________208______217_________________________ 

           __________255_______                                                                                                     
 1n0t(A) : EQGLLDKLKNKWWYDKGEC*                                                                                                     
         :                                                                                                                          
 1mqj(A) : EQGLLDKLKNKWWYDKGECG                                                                                                     
           __________255_______                                                                                                     

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 5.8 0.2 89.6   11 - 12   15 - 17   35 - 36 Bending Region Analysis
1 3 11.1 -0.3 72.6   108 - 109   217 - 220   255 - 258 Bending Region Analysis
4 3 8.5 -0.1 97.5   111 - 112   191 - 192   208 - 209   211 - 212 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 4

Movement classification:

No Contacts

CYTIDYLATE KINASE

PyMOL Script

Download and extract PyMOL PML script file Download