Site-Specific Recombinase Inti4

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Site-Specific Recombinase Inti4
  Conformer 1
(PDB) 		2a3v (B)
  Conformer 2
(PDB) 		2a3v (C)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 197 1.57   104 - 300
2 91 1.76   4 - 94

Sequence


           _____________________________________________________________________________________87_________________________________ 
 2a3v(B) : MGSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDP 
         :                                                                                                                          
 2a3v(C) : MGSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDP 
           _____________________________________________________________________________________87_________________________________ 

           ________________________________________________________________________________________________________________________ 
 2a3v(B) : KHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH 
         :                                                                                                                          
 2a3v(C) : KHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________________                                         
 2a3v(B) : HMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPLSRL                                         
         :                                                                                                                          
 2a3v(C) : HMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTH---rGASGVLSPLSRL                                         
           ________________________________________________________________________________                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.2
Translation
(A) 		0.1
Closure
(%) 		98.5
Bending Residues
( green ) 		  150 - 151
  155 - 162
  166 - 167
  170 - 177
  193 - 194
  293 - 294
  301 - 302
  306 - 309
  313 - 314
  317 - 318
  326 - 327
  329 - 330
  338 - 339
  341 - 342
  344 - 345
  351 - 352
  368 - 369
  373 - 374
  376 - 377
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.5
Translation
(A) 		-0.1
Closure
(%) 		96.8
Bending Residues
( green ) 		  214 - 215
  222 - 224
  250 - 253
  269 - 270
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download