Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cll (A)
  Conformer 2
(PDB) 		1a29  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 71 1.05   6 - 76
2 68 1.68   77 - 144

Sequence


           _____________________________________________________________________73_________________________________________________ 
 1cll(A) : *LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVD 
         :                                                                                                                          
 1a29    : QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVD 
           _____________________________________________________________________73_________________________________________________ 

           _________________________                                                                                                
 1cll(A) : EMIREADIDGDGQVNYEEFVQMMTA                                                                                                
         :                                                                                                                          
 1a29    : EMIREADIDGDGQVNYEEFVQMMT*                                                                                                
           _________________________                                                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		140.5
Translation
(A) 		-3.8
Closure
(%) 		91.2
Bending Residues
( green ) 		  73 - 80
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download