Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		6fqj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 144 1.59   7 - 109   214 - 254
2 106 1.47   110 - 213   255 - 256

Sequence


           _________________________________________________________________________________________________________109____________ 
 2f36(A) : **TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQN-DKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPID 
         :                                                                                                                          
 6fqj(A) : NKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIE 
           _________________________________________________________________________________________________________110____________ 

           ____________________________________________________________________________________________213_________________________ 
 2f36(A) : SADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTD--YALLMESTSIEYVTQRN-CNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQ 
         :                                                                                                                          
 6fqj(A) : SAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVCGNLDSKGYGIATPKGSSLGNAVNLAVLKLN 
           ____________________________________________________________________________________________217_________________________ 

           __________251________                                                                                                    
 2f36(A) : EEGKLHMMKEKWWRGNG-CPS                                                                                                    
         :                                                                                                                          
 6fqj(A) : EQGLLDKLKNKWWYDKGECGS                                                                                                    
           __________255________                                                                                                    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		31.7
Translation
(A) 		0.7
Closure
(%) 		98.2
Bending Residues
( green ) 		  109 - 110
  213 - 214
  251 - 255
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download