Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		1lb9 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 147 1.32   7 - 109   193 - 195   213 - 253
2 100 1.42   110 - 192   196 - 212

Sequence


           _______________________________________________________________________________________________________109______________ 
 2f36(A) : TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQN-DKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
         :                                                                                                                          
 1lb9(A) : TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPIESA 
           _______________________________________________________________________________________________________110______________ 

           ____________________________________________________________________192__________________212____________________________ 
 2f36(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTD--YALLMESTSIEYVTQRN-CNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 
         :                                                                                                                          
 1lb9(A) : EDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQ 
           ____________________________________________________________________195__________________216____________________________ 

           ___________________                                                                                                      
 2f36(A) : GKLHMMKEKWWRGNG-CPS                                                                                                      
         :                                                                                                                          
 1lb9(A) : GLLDKLKNKWWYDKGEC**                                                                                                      
           ___________________                                                                                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		23.5
Translation
(A) 		0.0
Closure
(%) 		91.4
Bending Residues
( green ) 		  109 - 110
  192 - 193
  195 - 196
  212 - 213
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download