Colicin E7

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Colicin E7
  Conformer 1
(PDB) 		1unk (A)
  Conformer 2
(PDB) 		1ayi  
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 47 0.49   9 - 54   56 - 56
2 33 0.82   4 - 8   55 - 55   57 - 83

Sequence


           _______8____________________________________________54_________________________________                                  
 1unk(A) : MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG                                  
         :                                                                                                                          
 1ayi    : MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ*                                  
           _______8____________________________________________54_________________________________                                  

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.6
Translation
(A) 		0.4
Closure
(%) 		96.4
Bending Residues
( green ) 		  8 - 9
  54 - 57
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download