Geranylgeranyltransferase Type I Alpha Subunit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Geranylgeranyltransferase Type I Alpha Subunit
  Conformer 1
(PDB)
1tno (K)
  Conformer 2
(PDB)
2f0y (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 146 0.53   133 - 135   140 - 278   281 - 284
2 80 0.7   57 - 132   136 - 139
3 35 0.6   279 - 280   285 - 315   318 - 319
4 46 0.58   316 - 317   320 - 363

Sequence


           ___________________________________________________________________________132____139___________________________________ 
 1tno(K) : FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRV 
         :                                                                                                                          
 2f0y(A) : FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRV 
           ___________________________________________________________________________132____139___________________________________ 

           _____________________________________________________________________________________________________278___284__________ 
 1tno(K) : LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPN 
         :                                                                                                                          
 2f0y(A) : LVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPN 
           _____________________________________________________________________________________________________278___284__________ 

           __________________315_____________________________________________________                                               
 1tno(K) : LLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS                                               
         :                                                                                                                          
 2f0y(A) : LLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS                                               
           __________________315_____________________________________________________                                               

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 9.1 -0.5 80.2   132 - 133   135 - 136   139 - 140 Bending Region Analysis
1 3 6.2 -0.7 99.5   278 - 281   284 - 287 Bending Region Analysis
3 4 6.5 -0.5 34.6   315 - 320 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 3

Movement classification: Hinge

Dephospho-CoA kinase

PyMOL Script

Download and extract PyMOL PML script file Download