Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5sy1 (C)
  Conformer 2
(PDB) 		3wfn (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 41 1.62   4 - 28   62 - 77
2 29 1.78   29 - 61
3 66 3.43   78 - 146

Sequence


           _______________________________28_________________________55____________________77______________________________________ 
 5sy1(C) : ******ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE 
         :                                                                                                                          
 3wfn(B) : HHHHHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV----nGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE 
           _______________________________28_________________________55____________________77______________________________________ 

           ________________________________________________________                                                                 
 5sy1(C) : KLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS***********************                                                                 
         :                                                                                                                          
 3wfn(B) : KLTDEEVDEMIREAi---DgQVNYEEFVQMMTAgGEEVSAVVLQRAYRGHLARRGF                                                                 
           ________________________________________________________                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		59.1
Translation
(A) 		1.7
Closure
(%) 		93.3
Bending Residues
( green ) 		  28 - 31
  55 - 63
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		127.7
Translation
(A) 		-4.1
Closure
(%) 		89.3
Bending Residues
( green ) 		  77 - 78
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download