Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5k8q (A)
  Conformer 2
(PDB) 		6b8l (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 29 2.21   77 - 100   130 - 137
2 72 1.26   5 - 76
3 36 2.66   101 - 128   138 - 145

Sequence


           ____________________________________________________________________71__________________________100_____________________ 
 5k8q(A) : DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK---sEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV 
         :                                                                                                                          
 6b8l(F) : *QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV 
           ____________________________________________________________________71__________________________100_____________________ 

           ____128______137__________                                                                                               
 5k8q(A) : DEMIREADIDGDGQVNYEEFVQMMTA                                                                                               
         :                                                                                                                          
 6b8l(F) : DEMIREADIDGDGQVNYEEFVQMMTA                                                                                               
           ____128______137__________                                                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		118.0
Translation
(A) 		-4.3
Closure
(%) 		7.1
Bending Residues
( green ) 		  71 - 77
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		33.4
Translation
(A) 		1.2
Closure
(%) 		82.9
Bending Residues
( green ) 		  100 - 101
  128 - 130
  137 - 138
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download