Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		6fqh (B)
  Conformer 2
(PDB) 		1ftj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 25 0.34   109 - 111   192 - 208   210 - 210   216 - 218   259 - 259
2 143 0.4   6 - 108   219 - 258
3 86 0.37   112 - 191   209 - 209   211 - 215

Sequence


           ______________________________________________________________________________________________________108_______________ 
 6fqh(B) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1ftj(A) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           ______________________________________________________________________________________________________108_______________ 

           _________________________________________________________________191______________208_____216___________________________ 
 6fqh(B) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDCKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1ftj(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _________________________________________________________________191______________208_____216___________________________ 

           ________254_______                                                                                                       
 6fqh(B) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1ftj(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
           ________254_______                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.2
Translation
(A) 		0.1
Closure
(%) 		93.2
Bending Residues
( green ) 		  108 - 109
  216 - 220
  254 - 259
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.5
Translation
(A) 		-0.1
Closure
(%) 		100.0
Bending Residues
( green ) 		  111 - 112
  191 - 193
  208 - 211
  215 - 218
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download