Glutamate Receptor 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 2
  Conformer 1
(PDB) 		3bki (P)
  Conformer 2
(PDB) 		1ftj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 32 0.33   110 - 111   182 - 186   192 - 213   215 - 217
2 145 0.39   7 - 109   218 - 259
3 76 0.33   112 - 181   187 - 191   214 - 214

Sequence


           _______________________________________________________________________________________________________109______________ 
 3bki(P) : *TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1ftj(A) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           _______________________________________________________________________________________________________109______________ 

           _______________________________________________________181__186__191___________________213_217__________________________ 
 3bki(P) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1ftj(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _______________________________________________________181__186__191___________________213_217__________________________ 

           __________________                                                                                                       
 3bki(P) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1ftj(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
           __________________                                                                                                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.0
Translation
(A) 		-0.3
Closure
(%) 		91.0
Bending Residues
( green ) 		  109 - 110
  217 - 218
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		5.5
Translation
(A) 		-0.2
Closure
(%) 		97.9
Bending Residues
( green ) 		  111 - 112
  181 - 182
  186 - 187
  191 - 192
  213 - 215
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download