Glutamate Receptor 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 2
  Conformer 1
(PDB) 		3bki (C)
  Conformer 2
(PDB) 		1ftj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 36 0.3   110 - 111   114 - 117   181 - 186   192 - 214   216 - 216
2 146 0.36   7 - 109   217 - 259
3 71 0.36   112 - 113   118 - 180   187 - 191   215 - 215

Sequence


           _______________________________________________________________________________________________________109_____117______ 
 3bki(C) : *TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1ftj(A) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           _______________________________________________________________________________________________________109_____117______ 

           _____________________________________________________179__184____191______________________216___________________________ 
 3bki(C) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1ftj(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _____________________________________________________179__184____191______________________216___________________________ 

           __________________                                                                                                       
 3bki(C) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1ftj(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
           __________________                                                                                                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.8
Translation
(A) 		-0.1
Closure
(%) 		84.9
Bending Residues
( green ) 		  109 - 110
  216 - 218
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		5.7
Translation
(A) 		-0.1
Closure
(%) 		96.2
Bending Residues
( green ) 		  111 - 114
  117 - 118
  179 - 181
  184 - 187
  191 - 193
  214 - 216
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download