Glutamate Receptor 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 2
  Conformer 1
(PDB) 		3r7x (A)
  Conformer 2
(PDB) 		1ftj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 24 0.45   109 - 111   193 - 206   213 - 218   259 - 259
2 143 0.37   6 - 108   219 - 258
3 87 0.38   112 - 192   207 - 212

Sequence


           _______________________________________________________________________________________________________108______________ 
 3r7x(A) : NKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIE 
         :                                                                                                                          
 1ftj(A) : *KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIE 
           _______________________________________________________________________________________________________108______________ 

           ___________________________________________________________________192___________206___212__217_________________________ 
 3r7x(A) : SAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLN 
         :                                                                                                                          
 1ftj(A) : SAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLN 
           ___________________________________________________________________192___________206___212__217_________________________ 

           _________254_______                                                                                                      
 3r7x(A) : EQGLLDKLKNKWWYDKGEC                                                                                                      
         :                                                                                                                          
 1ftj(A) : EQGLLDKLKNKWWYDKGEC                                                                                                      
           _________254_______                                                                                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.1
Translation
(A) 		-0.1
Closure
(%) 		85.6
Bending Residues
( green ) 		  108 - 109
  217 - 219
  254 - 259
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		10.6
Translation
(A) 		-0.1
Closure
(%) 		99.9
Bending Residues
( green ) 		  111 - 112
  192 - 193
  206 - 207
  212 - 213
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download