Autolysin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Autolysin
  Conformer 1
(PDB) 		1gvm (F)
  Conformer 2
(PDB) 		2bml (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 74 0.71   195 - 260   270 - 270   272 - 278
2 48 0.64   261 - 269   271 - 271   279 - 316

Sequence


           _________________________________________________________________________260______269______278__________________________ 
 1gvm(F) : GGIVHSDGSYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADR 
         :                                                                                                                          
 2bml(B) : ********SYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADR 
           _________________________________________________________________________260______269______278__________________________ 

           ______________                                                                                                           
 1gvm(F) : PEFTVEPDGLITVK                                                                                                           
         :                                                                                                                          
 2bml(B) : PEFTVEPDGLITVK                                                                                                           
           ______________                                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.7
Translation
(A) 		-0.3
Closure
(%) 		52.9
Bending Residues
( green ) 		  260 - 261
  269 - 272
  278 - 279
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download