Acetate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Acetate Kinase
  Conformer 1
(PDB)
1tuu (A)
  Conformer 2
(PDB)
1g99 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 272 1.71   91 - 102   107 - 128   147 - 384
2 122 0.43   3 - 90   103 - 106   129 - 146   385 - 396

Sequence


           _______________________________________________________________________________________89__________102__________________ 
 1tuu(A) : MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELA 
         :                                                                                                                          
 1g99(B) : MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELA 
           _______________________________________________________________________________________89__________102__________________ 

           _____128_____________144________________________________________________________________________________________________ 
 1tuu(A) : PLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGT 
         :                                                                                                                          
 1g99(B) : PLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGT 
           _____128_____________144________________________________________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1tuu(A) : RCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNK 
         :                                                                                                                          
 1g99(B) : RCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNK 
           ________________________________________________________________________________________________________________________ 

           _____________________384_______________                                                                                  
 1tuu(A) : IRGQEIDISTPDAKVRVFVIPTNEELAIARETKEIVETE                                                                                  
         :                                                                                                                          
 1g99(B) : IRGQEIDISTPDAKVRVFVIPTNEELAIARETKEIVET*                                                                                  
           _____________________384_______________                                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
28.1
Translation
(A)
-0.6
Closure
(%)
86.2
Bending Residues
( green )
  89 - 91
  102 - 107
  128 - 133
  144 - 147
  384 - 387
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download