Adenylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adenylate Kinase
  Conformer 1
(PDB)
1nks (F)
  Conformer 2
(PDB)
1nks (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 141 0.76   3 - 37   83 - 108   113 - 192
2 26 0.7   39 - 64
3 22 0.74   65 - 82   109 - 112

Sequence


           ___________________________________37_________________________64_______________81________________________108_112________ 
 1nks(F) : MKIGIVTGIPGVGKSTVLAKVKEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIF 
         :                                                                                                                          
 1nks(A) : MKIGIVTGIPGVGKSTVLAKVKEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIF 
           ___________________________________37_________________________64_______________81________________________108_112________ 

           __________________________________________________________________________                                               
 1nks(F) : LLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK                                               
         :                                                                                                                          
 1nks(A) : LLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK                                               
           __________________________________________________________________________                                               

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 32.3 -0.3 99.1   37 - 39 Bending Region Analysis
1 3 17.3 -0.6 84.5   81 - 84   108 - 109   112 - 113 Bending Region Analysis
2 3 17.0 -0.3 61.9   64 - 65 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 2 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 2

Movement classification: Hinge

Glyceraldehyde 3-phosphate dehydrogenase

PyMOL Script

Download and extract PyMOL PML script file Download