Annexin III

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Annexin III
  Conformer 1
(PDB) 		1axn  
  Conformer 2
(PDB) 		1aii  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 215 0.33   5 - 119   124 - 128   136 - 142   146 - 152   156 - 159   246 - 322
2 103 0.35   120 - 123   129 - 135   143 - 145   153 - 155   160 - 245

Sequence


           ___________________________________________________________________________________________________________________119_1 
 1axn    : SASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR 
         :                                                                                                                          
 1aii    : *ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR 
           ___________________________________________________________________________________________________________________119_1 

           23__128_132_______142_______152____159__________________________________________________________________________________ 
 1axn    : TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL 
         :                                                                                                                          
 1aii    : TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL 
           23__128_132_______142_______152____159__________________________________________________________________________________ 

           _245_______________________________________________________________________________                                      
 1axn    : LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD                                      
         :                                                                                                                          
 1aii    : LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD                                      
           _245_______________________________________________________________________________                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 9.0 0.3 89.6   26 - 27   31 - 32   156 - 157   185 - 186   188 - 189   202 - 203 Bending Region Analysis
1 3 10.6 -0.2 79.4   207 - 208 Bending Region Analysis
3 2 12.9 -0.7 11.7   217 - 219 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download