Beta-Phosphoglucomutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-Phosphoglucomutase
  Conformer 1
(PDB)
6hdf (B)
  Conformer 2
(PDB)
6hdl (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 27 0.43   80 - 88   114 - 127   138 - 141
2 64 0.62   16 - 79
3 21 0.33   12 - 14   89 - 98   128 - 129   202 - 207
4 97 0.39   3 - 11   99 - 113   132 - 134   142 - 201   208 - 217

Sequence


           _________11__________________________________________________________________79_______88________98____________113_______ 
 6hdf(B) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
         :                                                                                                                          
 6hdl(A) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSKEDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
           _________11__________________________________________________________________79_______88________98____________113_______ 

           ____127____134___140__________________________________________________________201___207____________                      
 6hdf(B) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLENSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
         :                                                                                                                          
 6hdl(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
           ____127____134___140__________________________________________________________201___207____________                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 20.5 0.7 99.0   79 - 81 Bending Region Analysis
1 3 6.9 0.1 27.5   88 - 89   127 - 128 Bending Region Analysis
1 4 9.5 0.2 97.9   113 - 114   134 - 138   140 - 146 Bending Region Analysis
3 4 5.9 -0.4 52.3   11 - 14   98 - 99   129 - 132   201 - 202   207 - 208 Bending Region Analysis
3 2 26.6 1.6 64.0   12 - 16 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 3

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification:

No Contacts

ATP synthase beta chain, mitochondrial

PyMOL Script

Download and extract PyMOL PML script file Download