Calmodulin (Vertebrate)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin (Vertebrate)
  Conformer 1
(PDB) 		1cll  
  Conformer 2
(PDB) 		1cdl (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 69 1.25   76 - 144
2 69 0.95   7 - 75

Sequence


           ___________________________________________________________________72___________________________________________________ 
 1cll    : LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDE 
         :                                                                                                                          
 1cdl(A) : *TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDE 
           ___________________________________________________________________72___________________________________________________ 

           ________________________                                                                                                 
 1cll    : MIREADIDGDGQVNYEEFVQMMTA                                                                                                 
         :                                                                                                                          
 1cdl(A) : MIREADIDGDGQVNYEEFVQMMT*                                                                                                 
           ________________________                                                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.7
Translation
(A) 		0.6
Closure
(%) 		24.3
Bending Residues
( green ) 		  31 - 34
  57 - 62
  82 - 83
  85 - 87
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising
ATP synthase beta chain, mitochondrial

PyMOL Script

Download and extract PyMOL PML script file Download