Casein Kinase 1 Gamma 2 Isoform

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Casein Kinase 1 Gamma 2 Isoform
  Conformer 1
(PDB)
2c47 (B)
  Conformer 2
(PDB)
2chl (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 240 0.78   7 - 7   11 - 11   20 - 23   31 - 31   55 - 70   78 - 295
2 43 1.29   6 - 6   8 - 10   12 - 19   24 - 30   32 - 54   72 - 77

Sequence


           _______6__10___________23_____30______________________54______________70_____77_________________________________________ 
 2c47(B) : *****PNFRVGKKIg-----ELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGP-gKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHT 
         :                                                                                                                          
 2chl(A) : VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHS 
           ______32__36___________49_____56______________________80______________96____103_________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2c47(B) : KSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEV 
         :                                                                                                                          
 2chl(A) : KNLIYRDVKPENFLIGRPGNKTQQVIHIIDFALAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEV 
           ________________________________________________________________________________________________________________________ 

           ____________________________________________________________                                                             
 2c47(B) : LCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPI                                                             
         :                                                                                                                          
 2chl(A) : LCENFPE-MATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTP*                                                             
           ____________________________________________________________                                                             

Morph

Morph animation in progress.
Status: Progress file not found. You may be seeing this after system maintenance due toan issue with some browsers. Please try closing and reopening your browser, or clearingyour browser's cookies. If this issue persists please contact us.

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
9.7
Translation
(A)
0.3
Closure
(%)
49.5
Bending Residues
( green )
  6 - 8
  10 - 20
  23 - 24
  30 - 32
  54 - 55
  70 - 72
  77 - 78
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download
Application loaded.