Dynamin-1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Dynamin-1
  Conformer 1
(PDB)
2x2e (A)
  Conformer 2
(PDB)
3zyc (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 254 1.4   33 - 291
2 22 2.75   9 - 25   29 - 32   730 - 730
3 26 2.85   26 - 28   292 - 304   732 - 741

Sequence


           ___________________25____31_____________________________________________________________________________________________ 
 2x2e(A) : **EDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRV 
         :                                                                                                                          
 3zyc(A) : SMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRV 
           ___________________25____31_____________________________________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2x2e(A) : YSPHVLNLTLVDLPG-tKVPVGDQPPDIEFQIRDl--qFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDL-dEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDG 
         :                                                                                                                          
 3zyc(A) : YSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDG 
           ________________________________________________________________________________________________________________________ 

           ____________________________________283__________________304______________________________________________               
 2x2e(A) : KKDITAALAAERKFFLSHPSYRHLADR-gTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDKHGTDSRVDElR-yHALKEALSIIG*****               
         :                                                                                                                          
 3zyc(A) : KKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVdEM----------------LRMYHALKEALSIIGNINTT               
           ____________________________________283__________________304______________________________________________               

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 65.9 -4.5 99.8   31 - 34 Bending Region Analysis
1 3 45.8 -2.3 96.0   283 - 292 Bending Region Analysis
2 3 22.3 -2.4 93.2   25 - 29   304 - 732 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 2 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 2

Movement classification: Hinge

Isocitrate dehydrogenase [NADP] cytoplasmic

PyMOL Script

Download and extract PyMOL PML script file Download