Elongation Factor Tu

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Elongation Factor Tu
  Conformer 1
(PDB)
1aip (A)
  Conformer 2
(PDB)
1aip (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 179 0.31   11 - 84   87 - 215
2 89 0.19   85 - 86   311 - 343   350 - 403
3 100 0.33   217 - 310   344 - 349

Sequence


           __________________________________________________84____________________________________________________________________ 
 1aip(A) : KPHVNVGTIGHVDHGKTTLTAALTYVTAAENPtAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEM 
         :                                                                                                                          
 1aip(B) : KPHVNVGTIGHVDHGKTTLTAALTYVTAAENPtAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEM 
           __________________________________________________84____________________________________________________________________ 

           _____________________________________________________208________________________________________________________________ 
 1aip(A) : EVRDLLNQYEFPGDEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRRTVVTGVEM 
         :                                                                                                                          
 1aip(B) : EVRDLLNQYEFPGDEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRRTVVTGVEM 
           _____________________________________________________208________________________________________________________________ 

           ___________________________________310__________________________339_______349___________________________________________ 
 1aip(A) : HRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG 
         :                                                                                                                          
 1aip(B) : HRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG 
           ___________________________________310__________________________339_______349___________________________________________ 

           _____________                                                                                                            
 1aip(A) : RTVGAGVVTKILE                                                                                                            
         :                                                                                                                          
 1aip(B) : RTVGAGVVTKILE                                                                                                            
           _____________                                                                                                            

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 6.5 0.1 89.0   84 - 91 Bending Region Analysis
1 3 12.2 0.1 89.6   208 - 217 Bending Region Analysis
2 3 5.7 0.0 12.8   310 - 311   339 - 345   349 - 350 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 2 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 2

Movement classification: Hinge

ATP synthase beta chain, mitochondrial

PyMOL Script

Download and extract PyMOL PML script file Download