Glutamine Aminotransferase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamine Aminotransferase
  Conformer 1
(PDB)
1v2d (A)
  Conformer 2
(PDB)
1v2e (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 247 0.45   3 - 15   35 - 133   138 - 138   142 - 142   147 - 196   204 - 283   303 - 307   309 - 309
2 113 0.75   16 - 34   134 - 137   139 - 141   143 - 146   197 - 203   284 - 302   308 - 308   310 - 365

Sequence


           ________9_______________________34______________________________________________________________________________________ 
 1v2d(A) : MRLHPRTEAA---iFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAF 
         :                                                                                                                          
 1v2e(B) : MRLHPRTEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAF 
           ________9_______________________34______________________________________________________________________________________ 

           __125_____________141__146_______________________________________________196____203_____________________________________ 
 1v2d(A) : LAGAKARLVRLDLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEF 
         :                                                                                                                          
 1v2e(B) : LAGAKARLVRLDLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEF 
           __125_____________141__146_______________________________________________196____203_____________________________________ 

           ________________________________________283________________302__307_____________________________________________________ 
 1v2d(A) : MPRLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRLVEEARVALIPASAFYLEDPPKDLFRFAFCKTEEELHLA 
         :                                                                                                                          
 1v2e(B) : MPRLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRLVEEARVALIPASAFYLEDPPKDLFRFAFCKTEEELHLA 
           ________________________________________283________________302__307_____________________________________________________ 

           ________                                                                                                                 
 1v2d(A) : LERLGRVV                                                                                                                 
         :                                                                                                                          
 1v2e(B) : LERLGRV*                                                                                                                 
           ________                                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
6.0
Translation
(A)
0.0
Closure
(%)
95.3
Bending Residues
( green )
  9 - 17
  34 - 37
  125 - 139
  141 - 143
  146 - 147
  196 - 197
  203 - 204
  283 - 284
  302 - 303
  307 - 310
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download