Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB)
3s2v (B)
  Conformer 2
(PDB)
4mf3 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 145 0.69   6 - 109   212 - 252
2 85 0.52   110 - 110   113 - 186   190 - 190   194 - 196   206 - 211
3 20 0.63   111 - 112   187 - 189   191 - 193   197 - 205   253 - 255

Sequence


           ___________________________________________________________________________________________________________109__________ 
 3s2v(B) : *GANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTP 
         :                                                                                                                          
 4mf3(A) : SLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTP 
           ___________________________________________________________________________________________________________110__________ 

           ________________________________________________________________186____193_________205_209______________________________ 
 3s2v(B) : IDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQE 
         :                                                                                                                          
 4mf3(A) : IDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQE 
           ________________________________________________________________187____194_________206_210______________________________ 

           ________250_______                                                                                                       
 3s2v(B) : EGKLHMMKEKWWRGNGCP                                                                                                       
         :                                                                                                                          
 4mf3(A) : EGKLHMMKEKWWRGNGCP                                                                                                       
           ________251_______                                                                                                       

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 11.1 0.2 82.2   109 - 110   209 - 213 Bending Region Analysis
1 3 15.4 -0.3 66.5   109 - 111   250 - 255 Bending Region Analysis
2 3 9.4 0.1 100.0   110 - 113   186 - 187   189 - 191   193 - 194   196 - 197   205 - 206 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 2 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 2

Movement classification: Hinge

Putative phosphoglycolate phosphatase

PyMOL Script

Download and extract PyMOL PML script file Download