Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		4l17 (G)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 167 1.51   7 - 110   116 - 121   175 - 179   191 - 191   194 - 203   213 - 253
2 80 1.51   111 - 115   122 - 174   180 - 190   192 - 193   204 - 212

Sequence


           _________________________________________________________________________________________________________110__115___121_ 
 2f36(A) : *TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQN-DKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
         :                                                                                                                          
 4l17(G) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPIES 
           _________________________________________________________________________________________________________111__116___122_ 

           _________________________________________________174__179__________190___________203______212___________________________ 
 2f36(A) : ADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTD--YALLMESTSIEYVTQRN-CNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQE 
         :                                                                                                                          
 4l17(G) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKICVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _________________________________________________175__180__________193___________207______216___________________________ 

           ____________________                                                                                                     
 2f36(A) : EGKLHMMKEKWWRGNG-CPS                                                                                                     
         :                                                                                                                          
 4l17(G) : QGLLDKLKNKWWYDKGEC**                                                                                                     
           ____________________                                                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 8.6 0.4 85.0   157 - 160   165 - 168   171 - 172 Bending Region Analysis
1 3 10.9 -0.5 72.2   219 - 220   226 - 227   238 - 239   242 - 245   258 - 259   267 - 273 Bending Region Analysis
1 4 10.2 -0.3 90.0   294 - 295   299 - 301   304 - 305   314 - 315   327 - 329 Bending Region Analysis
5 2 11.5 -0.5 19.6   109 - 120 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 5 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 5

Movement classification: Hinge
ASPARTYL-TRNA SYNTHETASE

PyMOL Script

Download and extract PyMOL PML script file Download