Intercellular Adhesion Molecule-1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Intercellular Adhesion Molecule-1
  Conformer 1
(PDB) 		1p53 (B)
  Conformer 2
(PDB) 		1p53 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 24 0.27   295 - 295   334 - 336   366 - 370   394 - 400   431 - 438
2 159 0.92   187 - 294   296 - 333   337 - 365
3 59 0.42   371 - 393   403 - 430   439 - 446

Sequence


           ___________________________________________________________________________________________________________294__________ 
 1p53(B) : FVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVK 
         :                                                                                                                          
 1p53(A) : FVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVK 
           ___________________________________________________________________________________________________________294__________ 

           __________333_____________________________365__370____________________393____400___________________________430_____438__ 
 1p53(B) : CEAgPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVT 
         :                                                                                                                          
 1p53(A) : CEAgPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVT 
           __________333_____________________________365__370____________________393____400___________________________430_____438__ 

           __________                                                                                                               
 1p53(B) : REVTVNVLSP                                                                                                               
         :                                                                                                                          
 1p53(A) : REVTVNVLSP                                                                                                               
           __________                                                                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.4
Translation
(A) 		0.3
Closure
(%) 		51.7
Bending Residues
( green ) 		  294 - 296
  333 - 334
  336 - 337
  365 - 366
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.1
Translation
(A) 		0.2
Closure
(%) 		64.8
Bending Residues
( green ) 		  370 - 375
  393 - 394
  400 - 403
  430 - 431
  438 - 439
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download