Mitomycin-Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mitomycin-Binding Protein
  Conformer 1
(PDB) 		1kmz (A)
  Conformer 2
(PDB) 		2a4x (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 63 1.62   5 - 70
2 58 0.4   71 - 128

Sequence


           ___________________________________________________________62___________________________________________________________ 
 1kmz(A) : *ARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQA---gHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGN 
         :                                                                                                                          
 2a4x(A) : SARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGN 
           ___________________________________________________________62___________________________________________________________ 

           ___________                                                                                                              
 1kmz(A) : VVDLFAPLP**                                                                                                              
         :                                                                                                                          
 2a4x(A) : VVDLFAPLPLE                                                                                                              
           ___________                                                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		180.0
Translation
(A) 		-0.8
Closure
(%) 		100.0
Bending Residues
( green ) 		  62 - 72
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download