Moad Related Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Moad Related Protein
  Conformer 1
(PDB) 		1v8c (D)
  Conformer 2
(PDB) 		1v8c (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 62 0.53   18 - 71   78 - 89
2 21 0.39   3 - 17   72 - 77
3 73 0.41   90 - 162

Sequence


           _______________17____________________________________________________71____77__________89_______________________________ 
 1v8c(D) : PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRL 
         :                                                                                                                          
 1v8c(B) : PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPP----gFERTFGAFPPWLLERYLEEWGGTREGEGVYRL 
           _______________17____________________________________________________71____77__________89_______________________________ 

           _____________________________________________                                                                            
 1v8c(D) : PGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR                                                                            
         :                                                                                                                          
 1v8c(B) : PGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAAS*                                                                            
           _____________________________________________                                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.9
Translation
(A) 		-0.1
Closure
(%) 		89.5
Bending Residues
( green ) 		  17 - 20
  71 - 72
  77 - 78
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.0
Translation
(A) 		0.2
Closure
(%) 		16.1
Bending Residues
( green ) 		  89 - 90
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download