Moesin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Moesin
  Conformer 1
(PDB) 		1e5w (A)
  Conformer 2
(PDB) 		1ef1 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 239 1.66   6 - 207   212 - 240   283 - 295
2 46 1.13   208 - 211   241 - 282

Sequence


           ________________________________________________________________________________________________________________________ 
 1e5w(A) : MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE 
         :                                                                                                                          
 1ef1(A) : ***TISVRVTT-dAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE 
           ________________________________________________________________________________________________________________________ 

           ____________________________________________________________________________________207_211__________________________240 
 1e5w(A) : TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF 
         :                                                                                                                          
 1ef1(A) : TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRG-lREDAVLEYLKIAQDLE-yGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF 
           ____________________________________________________________________________________207_211__________________________240 

           _______________________________________282________________________________________________________________               
 1e5w(A) : PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEE               
         :                                                                                                                          
 1ef1(A) : PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALC-gNHELY-rRRKP*************************************************               
           _______________________________________282________________________________________________________________               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.3
Translation
(A) 		-0.3
Closure
(%) 		43.1
Bending Residues
( green ) 		  207 - 208
  211 - 212
  240 - 241
  282 - 283
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download