Myosin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Myosin
  Conformer 1
(PDB) 		1br4 (H)
  Conformer 2
(PDB) 		1br1 (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 79 0.53   5 - 83
2 65 0.62   84 - 148

Sequence


           _______________________________________________________________________________83_______________________________________ 
 1br4(H) : FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEE 
         :                                                                                                                          
 1br1(F) : FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEE 
           _______________________________________________________________________________83_______________________________________ 

           ____________________________                                                                                             
 1br4(H) : EVEQLVAGHEDSNGCINYEELVRMVLSG                                                                                             
         :                                                                                                                          
 1br1(F) : EVEQLVAGHEDSNGCINYEELVRMVLSG                                                                                             
           ____________________________                                                                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.9
Translation
(A) 		-0.6
Closure
(%) 		100.0
Bending Residues
( green ) 		  83 - 84
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download