Non-Specific Lipid Transfer Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Non-Specific Lipid Transfer Protein
  Conformer 1
(PDB) 		2alg (B)
  Conformer 2
(PDB) 		2alg (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 37 0.58   12 - 28   63 - 82
2 20 0.36   3 - 11   29 - 39

Sequence


           __________11_______________28_________39____________________________________________________                             
 2alg(B) : MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK                             
         :                                                                                                                          
 2alg(A) : MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK                             
           __________11_______________28_________39____________________________________________________                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.2
Translation
(A) 		0.1
Closure
(%) 		90.3
Bending Residues
( green ) 		  11 - 12
  28 - 29
  39 - 63
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download