Nusa

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Nusa
  Conformer 1
(PDB) 		2cxc (A)
  Conformer 2
(PDB) 		2cy1 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 102 0.3   9 - 86   92 - 103   110 - 111   133 - 142
2 32 0.81   87 - 91   104 - 109   112 - 132

Sequence


           ______________________________________________________________________________86___91_________103___109_________________ 
 2cxc(A) : ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVK 
         :                                                                                                                          
 2cy1(A) : ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVK 
           ______________________________________________________________________________86___91_________103___109_________________ 

           ___132____________                                                                                                       
 2cxc(A) : RARLVLSKLFGVEKVVIR                                                                                                       
         :                                                                                                                          
 2cy1(A) : RARLVLSKLFGVEKVVIR                                                                                                       
           ___132____________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.4
Translation
(A) 		0.1
Closure
(%) 		99.3
Bending Residues
( green ) 		  86 - 87
  91 - 94
  103 - 104
  109 - 112
  132 - 135
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download