Omp Synthase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Omp Synthase
  Conformer 1
(PDB) 		1lh0 (B)
  Conformer 2
(PDB) 		1lh0 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 41 0.82   2003 - 2016   2035 - 2040   2123 - 2123   2151 - 2155   2165 - 2167   2174 - 2185
2 53 1.05   2017 - 2034   2156 - 2164   2186 - 2211
3 108 1.09   2041 - 2122   2124 - 2150   2168 - 2173

Sequence


           ____________2016______________2034__2040______________________________________________________________________________21 
 1lh0(B) : MKPYQRQFIEFALNKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRDLALLGRFYAEALVDSGIEFDLLFGPAYKGIPIATTTAVALAEHHDKDLPYCFNRKE-------gSLVGSALQGRV 
         :                                                                                                                          
 1lh0(A) : MKPYQRQFIEFALNKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRDLALLGRFYAEALVDSGIEFDLLFGPAYKGIPIATTTAVALAEHHDKDLPYCFNRKEAKDHGEGGSLVGSALQGRV 
           ____________1016______________1034__1040______________________________________________________________________________11 

           22________________________2150_2155_____2164_____2173________2185____________________________                            
 1lh0(B) : MLVDDVITAGTAIRESMEIIQAHGATLAGVLISLDRQERGRGEISAIQEVERDYGCKVISIITLKDLIAYLEEKPDMAEHLAAVRAYREEFGV                            
         :                                                                                                                          
 1lh0(A) : MLVDDVITAGTAIRESMEIIQAHGATLAGVLISLDRQERGRGEISAIQEVERDYGCKVISIITLKDLIAYLEEKPDMAEHLAAVRAYREEFGV                            
           22________________________1150_1155_____1164_____1173________1185____________________________                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.2
Translation
(A) 		-0.3
Closure
(%) 		83.1
Bending Residues
( green ) 		  2016 - 2017
  2034 - 2036
  2155 - 2156
  2164 - 2166
  2185 - 2186
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		15.7
Translation
(A) 		-0.2
Closure
(%) 		97.1
Bending Residues
( green ) 		  2040 - 2041
  2122 - 2124
  2150 - 2151
  2167 - 2168
  2173 - 2176
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download