Orotate Phosphoribosyltransferase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Orotate Phosphoribosyltransferase
  Conformer 1
(PDB) 		2aee (A)
  Conformer 2
(PDB) 		2aee (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 150 0.37   3 - 15   37 - 179
2 48 0.47   16 - 36   180 - 206

Sequence


           _______________15__________________35___________________________________________________________________________________ 
 2aee(A) : AAMTLASQIATQLLDIKAVYLKPEDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHFPEVEVIAGTATAGIPHGAIIADKMTLPFAYIRSKPKgNQIEGRVLKGQKMVIIE 
         :                                                                                                                          
 2aee(B) : **MTLASQIATQLLDIKAVYLKPEDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHFPEVEVIAGTATAGIPHGAIIADKMTLPFAYIRSKP--nQIEGRVLKGQKMVIIE 
           _______________15__________________35___________________________________________________________________________________ 

           ____________________________________________________177________________________________                                  
 2aee(A) : DLISTGGSVLDAAAAASREGADVLGVVAIFTYELPKASQNFKEAGIKLITLSNYTELIAVAKLQGYITNDGLHLLKKFKEDQVNWQ*                                  
         :                                                                                                                          
 2aee(B) : DLISTGGSVLDAAAAASREGADVLGVVAIFTYELPKASQNFKEAGIKLITLSNYTELIAVAKLQGYITNDGLHLLKKFKEDQVNWQQ                                  
           ____________________________________________________177________________________________                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.6
Translation
(A) 		0.2
Closure
(%) 		30.8
Bending Residues
( green ) 		  15 - 16
  35 - 38
  177 - 180
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download