Outer Surface Protein A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Outer Surface Protein A
  Conformer 1
(PDB)
2fkg (A)
  Conformer 2
(PDB)
2hkd (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 124 0.57   158 - 159   166 - 167   172 - 219   227 - 238   245 - 258   273 - 294   300 - 300   305 - 314   328 - 340
2 48 0.44   120 - 157   160 - 165   168 - 171
3 20 0.68   220 - 226   239 - 242   259 - 267
4 22 0.52   295 - 299   301 - 304   315 - 327
5 81 0.86   30 - 110

Sequence


           _______________________________________________________________________________109______________________________________ 
 2fkg(A) : NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEE 
         :                                                                                                                          
 2hkd(A) : NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEE 
           _______________________________________________________________________________109______________________________________ 

           _______157_____165___171_____________________________________________219____226_________238_242_____________258______267 
 2fkg(A) : KFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVS 
         :                                                                                                                          
 2hkd(A) : KFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVS 
           _______157_____165___171_____________________________________________219____226_________238_242_____________258______267 

           ________________________294__299__304_______314__________327_______________                                              
 2fkg(A) : VELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK                                              
         :                                                                                                                          
 2hkd(A) : VELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK                                              
           ________________________294__299__304_______314__________327_______________                                              

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 8.6 0.4 85.0   157 - 160   165 - 168   171 - 172 Bending Region Analysis
1 3 10.9 -0.5 72.2   219 - 220   226 - 227   238 - 239   242 - 245   258 - 259   267 - 273 Bending Region Analysis
1 4 10.2 -0.3 90.0   294 - 295   299 - 301   304 - 305   314 - 315   327 - 329 Bending Region Analysis
5 2 11.5 -0.5 19.6   109 - 120 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 5 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 5

Movement classification: Hinge

ASPARTYL-TRNA SYNTHETASE

PyMOL Script

Download and extract PyMOL PML script file Download