Pantothenate Kinase 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pantothenate Kinase 1
  Conformer 1
(PDB) 		2i7n (B)
  Conformer 2
(PDB) 		2i7n (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 251 0.52   239 - 241   244 - 248   273 - 276   295 - 298   310 - 340   343 - 383   387 - 388   408 - 588
2 36 0.59   242 - 243   249 - 253   277 - 294   299 - 309   341 - 342
3 20 0.34   386 - 386   389 - 407

Sequence


           ___239______248__253__________________________294_298______309________________340_______________________________________ 
 2i7n(B) : PPFPWFGMDIGGTLVKLVYFEPKDIkSIRKYLTSNTAYGKTGIRDVHLELKNLTMrKGNLHFIRFPSCAMHRFIQM-cATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGF 
         :                                                                                                                          
 2i7n(A) : **FPWFGMDIGGTLVKLVYFEPKDlKSIRKYLTSNTAYGKTGIRDVHLELKNLTMrKGNLHFIRFPSCAMHRFIQMGcATGGGAFKFEEDF-------lHKLDELDCLIQGLLYVDSVGF 
           ___239______248__253__________________________294_298______309________________340_______________________________________ 

           _383_____________________407____________________________________________________________________________________________ 
 2i7n(B) : NGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGN 
         :                                                                                                                          
 2i7n(A) : NGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGN 
           _383_____________________407____________________________________________________________________________________________ 

           ______________________________________________________________________________________________                           
 2i7n(B) : MMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK                           
         :                                                                                                                          
 2i7n(A) : MMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK                           
           ______________________________________________________________________________________________                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.8
Translation
(A) 		0.0
Closure
(%) 		84.2
Bending Residues
( green ) 		  239 - 244
  248 - 249
  253 - 277
  294 - 295
  298 - 299
  309 - 310
  340 - 345
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		6.1
Translation
(A) 		0.5
Closure
(%) 		97.5
Bending Residues
( green ) 		  383 - 389
  407 - 408
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download