P58-Cl42 Kir

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P58-Cl42 Kir
  Conformer 1
(PDB) 		1nkr  
  Conformer 2
(PDB) 		2dl2 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 1.46   14 - 16   70 - 71   100 - 198
2 87 1.51   8 - 13   17 - 69   72 - 99

Sequence


           ________13_16___________________________________________________69____________________________99________________________ 
 1nkr    : **RKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGEN 
         :                                                                                                                          
 2dl2(A) : AHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGES 
           ________13_16___________________________________________________69____________________________99________________________ 

           _____________________________________________________________________________                                            
 1nkr    : VTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVT                                            
         :                                                                                                                          
 2dl2(A) : VTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVI                                            
           _____________________________________________________________________________                                            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.9
Translation
(A) 		-0.6
Closure
(%) 		66.2
Bending Residues
( green ) 		  13 - 14
  16 - 17
  69 - 72
  99 - 100
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download