Phenazine Biosynthesis Protein Phzf

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Phenazine Biosynthesis Protein Phzf
  Conformer 1
(PDB) 		1xub (A)
  Conformer 2
(PDB) 		1u1w (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 76 0.45   7 - 20   52 - 59   73 - 118   249 - 250   264 - 269
2 55 0.3   3 - 6   21 - 51   60 - 72   270 - 276
3 143 0.32   119 - 248   251 - 263

Sequence


           ______6____________20____________________________50_____57__________69______________________________________________118_ 
 1xub(A) : *MHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVLKPRNGGDALIRIFTPVNELPFAGAPLLGTAIALGAHTDNHRLYLETQMGTIAFELERQNGSVIAASMDQ 
         :                                                                                                                          
 1u1w(B) : HMHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVLKPRNGGDALIRIFTPVNELPFAGHPLLGTAIALGAHTDNHRLYLETQMGTIAFELERQNGSVIAASMDQ 
           ______6____________20____________________________50_____57__________69______________________________________________118_ 

           ________________________________________________________________________________________________________________________ 
 1xub(A) : PIPTWTALGRDAELLKALGISDSTFPIEIYHNGPRHVFVGLPSIDALSALHPDHRALSNFHDMAINCFAGAGRRWRSRMFSPAYGVVEDAATGSAAGPLAIHLARHGQIEFGQPVEILQG 
         :                                                                                                                          
 1u1w(B) : PIPTWTALGRDAELLKALGISDSTFPIEIYHNGPRHVFVGLPSIDALSALHPDHRALSNFHDMAINCFAGAGRRWRSRMFSPAYGVVEDAATGSAAGPLAIHLARHGQIEFGQPVEILQG 
           ________________________________________________________________________________________________________________________ 

           ______248____________263___269_________                                                                                  
 1xub(A) : VEIGRPSLMFAKAEGRAEQLTRVEVSGNGVTFGRGTIVL                                                                                  
         :                                                                                                                          
 1u1w(B) : VEIGRPSLMFAKAEGRAEQLTRVEVSGNGVTFGRGTIVL                                                                                  
           ______248____________263___269_________                                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.2
Translation
(A) 		0.4
Closure
(%) 		93.9
Bending Residues
( green ) 		  6 - 7
  20 - 21
  50 - 52
  57 - 60
  69 - 73
  269 - 270
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.5
Translation
(A) 		-0.1
Closure
(%) 		83.3
Bending Residues
( green ) 		  118 - 119
  248 - 251
  263 - 264
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download