Phosphoadenosine Phosphosulfate Reductase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Phosphoadenosine Phosphosulfate Reductase
  Conformer 1
(PDB) 		2o8v (A)
  Conformer 2
(PDB) 		1sur  
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 167 0.59   21 - 156   182 - 212
2 29 0.66   6 - 20   168 - 181

Sequence


           _________________20_____________________________________________________________________________________________________ 
 2o8v(A) : SKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLW 
         :                                                                                                                          
 1sur    : SKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLW 
           _________________19_____________________________________________________________________________________________________ 

           ________________________________156______________________181_________________________________________________            
 2o8v(A) : EQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKlKRECGLHEG            
         :                                                                                                                          
 1sur    : EQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTH**************            
           ________________________________155______________________180_________________________________________________            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.7
Translation
(A) 		-0.2
Closure
(%) 		89.6
Bending Residues
( green ) 		  20 - 21
  156 - 170
  181 - 182
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download