Phosphoribosylaminoimidazole-Succinocarboxamide Synthase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Phosphoribosylaminoimidazole-Succinocarboxamide Synthase
  Conformer 1
(PDB)
1obg (A)
  Conformer 2
(PDB)
2cnv (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 143 0.54   74 - 74   116 - 257   259 - 264
2 75 0.37   17 - 21   39 - 67   258 - 258   265 - 304
3 67 0.41   4 - 16   22 - 38   75 - 111

Sequence


           _________12_______21_______________38___________________________67_____74__________________________________111__________ 
 1obg(A) : SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIV 
         :                                                                                                                          
 2cnv(A) : SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIV 
           _________12_______21_______________38___________________________67_____74__________________________________111__________ 

           ________________________________________________________________________________________________________________________ 
 1obg(A) : RGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 
         :                                                                                                                          
 2cnv(A) : RGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTK------dENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 
           ________________________________________________________________________________________________________________________ 

           _____________257____264__________________________________________                                                        
 1obg(A) : RFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH                                                        
         :                                                                                                                          
 2cnv(A) : RFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH                                                        
           _____________257____264__________________________________________                                                        

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 6.6 -0.1 82.5   67 - 74   257 - 259   264 - 265 Bending Region Analysis
1 3 7.6 -0.3 73.3   74 - 75   111 - 116 Bending Region Analysis
3 2 4.6 0.0 75.0   12 - 17   21 - 22   38 - 39   67 - 75 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download