Ribonuclease, Seminal

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ribonuclease, Seminal
  Conformer 1
(PDB) 		1tq9 (A)
  Conformer 2
(PDB) 		1r5c (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 96 0.45   24 - 121
2 20 2.63   4 - 23

Sequence


           _____________________23_________________________________________________________________________________________________ 
 1tq9(A) : KESAAAKFERQHMDSGNSPSSSSNYCNLMM--rKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHF 
         :                                                                                                                          
 1r5c(A) : KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHF 
           _____________________23_________________________________________________________________________________________________ 

           ____                                                                                                                     
 1tq9(A) : DASV                                                                                                                     
         :                                                                                                                          
 1r5c(A) : DASV                                                                                                                     
           ____                                                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		43.1
Translation
(A) 		-0.1
Closure
(%) 		88.5
Bending Residues
( green ) 		  23 - 24
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download