Ribulose Bisphosphate Carboxylase Small Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ribulose Bisphosphate Carboxylase Small Chain
  Conformer 1
(PDB) 		1upm (C)
  Conformer 2
(PDB) 		1aus (S)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 88 0.69   31 - 115   117 - 119
2 29 0.32   3 - 30   116 - 116

Sequence


           ____________________________30__________________________________________________________________________________115_____ 
 1upm(C) : MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKP 
         :                                                                                                                          
 1aus(S) : MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKP 
           ____________________________30__________________________________________________________________________________115_____ 

           ___                                                                                                                      
 1upm(C) : AGY                                                                                                                      
         :                                                                                                                          
 1aus(S) : AGY                                                                                                                      
           ___                                                                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.7
Translation
(A) 		0.2
Closure
(%) 		99.9
Bending Residues
( green ) 		  30 - 31
  115 - 117
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download