Sh3-Containing Grb2-Like Protein 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sh3-Containing Grb2-Like Protein 2
  Conformer 1
(PDB)
2d4c (B)
  Conformer 2
(PDB)
2d4c (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 141 0.82   42 - 166   218 - 248
2 38 0.46   25 - 41   197 - 217
3 33 0.47   14 - 24   167 - 196

Sequence


           ______________24_______________41_______________________________________________________________________________________ 
 2d4c(B) : QFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMIpGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI 
         :                                                                                                                          
 2d4c(D) : ***KATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM---yPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI 
           ______________24_______________41_______________________________________________________________________________________ 

           _______________________166___________________________196__________________217__________________________________          
 2d4c(B) : DPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA          
         :                                                                                                                          
 2d4c(D) : DPLQNLHDKDLREIQSALQHHLKKLEGRRLDFD--------iPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA          
           _______________________166___________________________196__________________217__________________________________          

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 10.3 0.3 43.5   41 - 42   217 - 218 Bending Region Analysis
1 3 15.5 -0.6 33.1   166 - 167 Bending Region Analysis
3 2 8.2 -0.1 55.6   24 - 27   196 - 197 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification:

No Contacts

GLUTAMATE DEHYDROGENASE

PyMOL Script

Download and extract PyMOL PML script file Download