Syntaxin 1A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Syntaxin 1A
  Conformer 1
(PDB) 		1hvv (A)
  Conformer 2
(PDB) 		1hvv (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 33 1.3   218 - 250
2 23 0.61   195 - 217

Sequence


           ________________________216________________________________________                                                      
 1hvv(A) : QALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK                                                      
         :                                                                                                                          
 1hvv(D) : ***SEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKK***                                                      
           ________________________216________________________________________                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		37.1
Translation
(A) 		-3.0
Closure
(%) 		88.6
Bending Residues
( green ) 		  216 - 219
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download