Tail Needle Protein Gp26

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tail Needle Protein Gp26
  Conformer 1
(PDB)
3c9i (A)
  Conformer 2
(PDB)
3c9i (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 62 0.51   1003 - 1007   1052 - 1107   1111 - 1111
2 33 0.56   1019 - 1051
3 32 0.29   1108 - 1110   1112 - 1140
4 91 0.37   1141 - 1231

Sequence


           ________1003____________________________________________1051____________________________________________________1107____ 
 3c9i(A) : *********MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGE 
         :                                                                                                                          
 3c9i(B) : GALVPRGSHMADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGE 
           ________1003____________________________________________1051____________________________________________________1107____ 

           _________________________1140___________________________________________________________________________________________ 
 3c9i(A) : IASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAMEDALRAHGL 
         :                                                                                                                          
 3c9i(B) : IASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAMEDALRAHGL 
           _________________________1140___________________________________________________________________________________________ 

           __                                                                                                                       
 3c9i(A) : ID                                                                                                                       
         :                                                                                                                          
 3c9i(B) : ID                                                                                                                       
           __                                                                                                                       

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 10.5 -0.4 92.7   1003 - 1019   1051 - 1052 Bending Region Analysis
1 3 8.3 0.5 97.9   1107 - 1108   1110 - 1112 Bending Region Analysis
4 3 8.3 0.3 100.0   1140 - 1141 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 4

Movement classification:

No Contacts

beta-phosphoglucomutase

PyMOL Script

Download and extract PyMOL PML script file Download