Transcription Factor Relb

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcription Factor Relb
  Conformer 1
(PDB) 		1zk9 (A)
  Conformer 2
(PDB) 		1zka (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 63 0.22   271 - 333
2 43 0.2   334 - 376

Sequence


           _____________________________________________________________332______________________________________________           
 1zk9(A) : LVPRGSHMNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR           
         :                                                                                                                          
 1zka(A) : LVPRGSHMNTSELRICRINKESGPCTGGEELSLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR           
           _____________________________________________________________332______________________________________________           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		24.4
Translation
(A) 		0.7
Closure
(%) 		99.1
Bending Residues
( green ) 		  332 - 335
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download