Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		1ytz (C)
  Conformer 2
(PDB) 		1a2x (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 53 1.55   6 - 37   39 - 40   71 - 89
2 31 1.89   38 - 38   41 - 70
3 66 1.0   94 - 159

Sequence


           _________________________________37___________________________66____________________88__________________________________ 
 1ytz(C) : TDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILR 
         :                                                                                                                          
 1a2x(A) : *DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFR 
           _________________________________35___________________________64____________________86__________________________________ 

           _______________________________________                                                                                  
 1ytz(C) : ATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ                                                                                  
         :                                                                                                                          
 1a2x(A) : ASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ                                                                                  
           _______________________________________                                                                                  

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		46.7
Translation
(A) 		1.5
Closure
(%) 		92.6
Bending Residues
( green ) 		  37 - 41
  66 - 72
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		122.4
Translation
(A) 		-0.6
Closure
(%) 		86.2
Bending Residues
( green ) 		  88 - 94
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download