Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		1tcf  
  Conformer 2
(PDB) 		2tn4  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 77 0.68   4 - 39   60 - 100
2 20 0.43   40 - 59
3 25 0.74   101 - 110   139 - 153

Sequence


           _____________________________________39__________________59______________________________91_____________________________ 
 1tcf    : *DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFR 
         :                                                                                                                          
 2tn4    : TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFR 
           _____________________________________39__________________59______________________________91_____________________________ 

           _____________________________________                                                                                    
 1tcf    : ASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG                                                                                    
         :                                                                                                                          
 2tn4    : ASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMM**                                                                                    
           _____________________________________                                                                                    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.6
Translation
(A) 		-0.6
Closure
(%) 		55.2
Bending Residues
( green ) 		  39 - 40
  59 - 60
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		18.5
Translation
(A) 		0.3
Closure
(%) 		98.7
Bending Residues
( green ) 		  91 - 102
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download