Urokinase-Type Plasminogen Activator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Urokinase-Type Plasminogen Activator
  Conformer 1
(PDB) 		2i9a (B)
  Conformer 2
(PDB) 		2i9b (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 86 0.39   45 - 130
2 32 1.39   13 - 44

Sequence


           _____________________________________44_________________________________________________________________________________ 
 2i9a(B) : QVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQE 
         :                                                                                                                          
 2i9b(A) : *****CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQE 
           _____________________________________44_________________________________________________________________________________ 

           _______                                                                                                                  
 2i9a(B) : CMVHDCA                                                                                                                  
         :                                                                                                                          
 2i9b(A) : CMVHDCA                                                                                                                  
           _______                                                                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		22.8
Translation
(A) 		-1.0
Closure
(%) 		99.9
Bending Residues
( green ) 		  44 - 45
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download