V-Type Atp Synthase Subunit F

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name V-Type Atp Synthase Subunit F
  Conformer 1
(PDB) 		2d00 (B)
  Conformer 2
(PDB) 		2d00 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 55 0.5   6 - 40   47 - 66
2 50 0.59   3 - 5   41 - 46   67 - 107

Sequence


           __3___________________________________40____46__________________66___________________________________________            
 2d00(B) : MVPVRMAVIADPETAQGFRLAGLEGYGASSAEEAQSLLETLVERGGYALVAVDEALLPDPERAVERLMRGRDLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL            
         :                                                                                                                          
 2d00(A) : MVPVRMAVIADPETAQGFRLAGLEGYGASSAEEAQSLLETLVERGGYALVAVDEALLPDPERAVERLMRGRDLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL            
           __3___________________________________40____46__________________66___________________________________________            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.5
Translation
(A) 		-0.2
Closure
(%) 		97.7
Bending Residues
( green ) 		  3 - 6
  40 - 41
  46 - 47
  66 - 67
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download